PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G375675_P01
Common NameLOC103635017, ZEAMMB73_053248, Zm.2848
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Nin-like
Protein Properties Length: 927aa    MW: 102076 Da    PI: 5.8709
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G375675_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.85.1e-29581632152
             RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        aek+isle+l++yFs+++k+AAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  GRMZM2G375675_P01 581 AEKTISLEVLQQYFSGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 632
                        589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.655571652IPR003035RWP-RK domain
PfamPF020423.3E-26584632IPR003035RWP-RK domain
SuperFamilySSF542771.37E-20823918No hitNo description
SMARTSM006661.9E-24833915IPR000270PB1 domain
PROSITE profilePS5174517.825833915IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.6E-24833914No hitNo description
PfamPF005641.2E-14833914IPR000270PB1 domain
CDDcd064073.84E-33834914No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 927 aa     Download sequence    Send to blast
MDFDPSPASA HGDGSGGAWP FDSLTTSMLF SSVSASPQLP ASSSSWLTPP SPLWLFEDRH  60
LLPLDAPSAA PEAAVAAAVV EEVQRARSGN SHTTGKRVDQ INHKWQFHLS LDEDGTDNSS  120
FFKEKLTQAL RYFKESTDQH LLVQVWAPVK NGDRYVLTTS GQPFVLDHQS IGLLQYRAVS  180
MMYMFSVDGE NAGDLGLPGR VYKQKVPEWT PNVQYYSSGE YQRLNHAISY NVHGTVALPV  240
FDPSAQSCIA VVELIMTSKK INYACEVDKV CKALEAVNLK STEILDHPNV QICNEGRQAA  300
LVEILEILTV VCEEHKLPLA QTWVPCKYRS VLAHGGGLKK SCLSFDGSCM GEVCMSTSDV  360
AFHVIDAHMW GFRDACVEHH LQRGQGVSGK AFISHKPCFS KDIRKFCKLA YPLVHYARMF  420
GLSGCFAICL QSSYTGNDDY ILEFFLPLDC IDEDDQNALL ESILTLMKRC LRSLKLVDDN  480
DLSGVSLHLS NVLKLENEES KTDAQFDGSL RESPEDDRHG GSHKFDNENQ KVLDITEGQL  540
LTDDYSQDNG TSVGRPNGSG ASDSSLLHKT NKPPERRRGK AEKTISLEVL QQYFSGSLKN  600
AAKSLGVCPT TMKRICRQHG ISRWPSRKIN KVNRSLSKLK QVIESVQGSD AAFNLTSITG  660
PLPIPVGPSP ESLNVEKLTQ SKVAELSNLA VGVDRDSLQK SLENDDHFDI VMAQQGFIDN  720
NNDVQLEADK ASHSRSSSGE GSINSRTSEG SCQGSPANQT FVCKPIASMF AEPQLNQEEF  780
NKEPFQEPQL PLSRMLIEDS GSSKDLKNLF TSTSDQPFLA PPNNLVSMKH SGTVTIKASF  840
KEDIVRFRFP CSGGVIVLKE EVAKRLRMDV GTFDIKYLDD DHEWVKLACN ADLEECMEIS  900
RLSGSHVIRL LVSDIAAHFG SSCGSSG
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G375675
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G375675_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0853590.0BT085359.2 Zea mays full-length cDNA clone ZM_BFc0002J20 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008655807.10.0PREDICTED: protein NLP3-like
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLK7VRG40.0K7VRG4_MAIZE; Uncharacterized protein
STRINGGRMZM2G375675_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein